PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00019624-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family MYB_related
Protein Properties Length: 161aa    MW: 18790.3 Da    PI: 4.6627
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00019624-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.18.6e-0881119444
                       S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
   Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                       +++eE++l+++  k+ G++ W++Ia +++ g  ++++  +w
  PSME_00019624-RA  81 MSEEEEDLILRMYKLIGNK-WSLIAGRIP-GTKAEEIERYW 119
                       69*****************.*********.99999*99999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF002496.9E-781120IPR001005SANT/Myb domain
SuperFamilySSF466891.3E-581120IPR009057Homeodomain-like
CDDcd001675.04E-581119No hitNo description
Gene3DG3DSA:1.10.10.601.1E-982119IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    Send to blast
MQFLIEQWRD HLPPGYLLKK ASIDTPFEED ACRYHFVFVK DRNVYDEAEL ALRLQWFIGE  60
KTPTNFEIIK EGSSLDWECD MSEEEEDLIL RMYKLIGNKW SLIAGRIPGT KAEEIERYWA  120
MRTQQFCGSH GATIFASNKQ MGNMISIPYH INGCNDVEVN S
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53200.17e-21MYB_related family protein